PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G138500.1.p
Common NameLOC101782058, SETIT_015783mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 431aa    MW: 45651.2 Da    PI: 4.5344
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G138500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.81.7e-3883181199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC++dC+lapyfpa+q+++f n+h+lFG+sn+lk+lk+l++e   dam +l+y++++ra dPv G++++il+l++qle + 
  Seita.6G138500.1.p  83 ACAACKYQRRKCNQDCPLAPYFPADQQRRFLNAHRLFGVSNILKTLKRLRPELCADAMGTLIYQSDMRATDPVGGCYRLILSLERQLEIET 173
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         ael+++ +
  Seita.6G138500.1.p 174 AELSAVLH 181
                         **998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.99982183IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-3683179IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MTSSAVPAAA ASSHQQAPRL HITTTTTGTG TSTITTSPSS HHHHSPSSAR SAPHSASSSP  60
RGSSSNSGTA AGGGGGSGST NQACAACKYQ RRKCNQDCPL APYFPADQQR RFLNAHRLFG  120
VSNILKTLKR LRPELCADAM GTLIYQSDMR ATDPVGGCYR LILSLERQLE IETAELSAVL  180
HNLALYRQAA AAAAAAIPPQ EAGGAMAADL DVTSSNQPLL LDAEQEVVDA LYANHEADTA  240
AILQTDGVHR HDHGDDSPQD HGEQQQQQQQ LFDYFYYEAT ASDDASSKPT IDINLDNMQQ  300
FDFDDTCAAE KIDLAPAGPE EMGQPQHLDV NCQIDHKDYQ IKAAALVDAF DMRQELQPAV  360
DVNADVVVKA VDMNAGIGGV GIKAVDVNAN VDVNVDLQEE DPNNIAAGDE AVQMAAESSH  420
CRLGLGFSSF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973381.10.0PREDICTED: uncharacterized protein LOC101782058
TrEMBLK3YNE20.0K3YNE2_SETIT; Uncharacterized protein
STRINGSi015783m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.16e-38LOB domain-containing protein 22